DPCstruct | MC6677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 315 |
|---|---|
| Mean domain length (aa) | 219 ± 51 aa |
| Standard deviation of domain lengths | 50.80 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 21.74 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | CL0023- CL0063- CL0669- CL0021- PF08701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4GJL9 | 22-225 | MNKSDLVPRDVLDEWVEVFRREGLKATYISARERMGTMKLRRLIKGEAPEFPAVVLVVGFPKVGKSSIINVLKGRSSASTSPIPGNP… |
| A0A821ZTL1 | 23-235 | FVLNKCDLVPTWATKRWVAVLSKDYPTLAFHASLTNPFGKGAFIQLLRQFGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNV… |
| A0A7X3T5U5 | 3-172 | None |
| A0A2G6H3J8 | 18-212 | None |
| A0A5J4Z5B1 | 165-479 | None |
| C0AG71 | 71-230 | None |
| Q4N7Y9 | 308-529 | None |
| A0A7S3LWN3 | 2-196 | None |
| A0A2G2X9L5 | 442-647 | None |
| A0A655RKZ6 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.