DPCstruct | MC6676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P96966 | 20-229 | QSAKIKLDAPTTRTTCTNNSFKQFDASFSFNEVELTKVETKGGTFASVSIPGAFPTGEVGSPEVPAVRKLIAVPVGATPVVRVKSFT… |
| A0A662T0N1 | 23-195 | GVSVTLEFRGISVEEADRYAAVRVDNLGYMGDPGRPRLPCGVYHVLLPPGAVRVEVEAQPSDAVELRVSKPVEPAQPPACPLIEYRA… |
| A0A3G1KS85 | 568-760 | None |
| A0A2N2PUD7 | 48-261 | None |
| A0A660S539 | 12-198 | None |
| A0A151DUA5 | 16-169 | None |
| A0A0S7XSE0 | 39-240 | None |
| A0A661AJZ2 | 5-147 | None |
| A0A661ACH8 | 1-154 | None |
| A0A1V1P3J7 | 106-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.