DPCstruct | MC6671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 152 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2ZQ34 | 1-148 | MHLYIDTLKRRLDTINRLRVDRALVAMNPSCQKIYYLLPAFLHYHHPSMPGYLNSKVPHGVCSFTANEIQKQHLTQFTADWEEPRQP… |
| A0A6N0HSX5 | 18-158 | KAVRQRFQLLNISRLQRLRDALRSRQQPFIDILPLLFHINHPLLPGYISKETPAGVYDFQPTKAIVGSTKKLFKGFEHKRRALLRPY… |
| A0A448MTZ4 | 9-157 | None |
| A0A355B1N9 | 71-237 | None |
| A0A090TF28 | 1-152 | None |
| A0A2A5CWB4 | 24-163 | None |
| A0A3B0LZX6 | 9-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.