DPCstruct | MC6670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 269 ± 31 aa |
| Standard deviation of domain lengths | 31.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5EKB8 | 78-348 | RHVFEDCIASRPCVMGRDDHGDFHCSTHSTLFLPALVKGSALWKRVMEGLTFFGVAEENLSAVTAFRLDMVQRPRFTGQLFSTTSTT… |
| A0A7K2QLU8 | 1-293 | MFEECIATRPCLMSRQEEDNEFRCPTHGTLFLPALLRSSPLWKEIRQGLSLFGVAEDDLSAITSFRLDMVQRPRFTAQLRRPTASSP… |
| A0A814SVX8 | 355-596 | None |
| C9SD37 | 266-478 | None |
| A0A815AQS7 | 220-519 | None |
| A0A816QKV9 | 76-334 | None |
| A0A814U7A9 | 217-517 | None |
| A0A1K0GCV6 | 3-214 | None |
| A0A1V0AH06 | 4-279 | None |
| A0A2V3IJJ1 | 274-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.