DPCstruct | MC667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820MG02 | 8-65 | DERSQRSPAYSMLNKMYLDRIISPHDAKQFESLLTEHQKATTPDGYTILQRAVIEHNL |
| A0A453IR85 | 1-68 | DERCSKLKIYPILQKVFLERILRKPEIDAFAEELKPHQKALLPDNSTVLDRAMIEHNLLSASKLYTNI |
| A0A2G9SGL0 | 24-86 | None |
| A0A820X6A4 | 253-320 | None |
| A0A817CJ42 | 64-131 | None |
| A0A151MRF5 | 8-75 | None |
| A0A0K9Q4L8 | 2-73 | None |
| A0A0K9PH14 | 174-249 | None |
| A0A0K9PG22 | 114-183 | None |
| A0A0H5QVN3 | 36-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.