DPCstruct | MC6668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4MRD6 | 1-66 | MARIQILELPMVHVGDVSETPFLLVIDQVDDDTAEDITHWPEDIATRIGARQVLCLPGTVDIPAND |
| A0A212SWD9 | 1-73 | MPRLQILELPDGAREDSPPFVLVIDQAPSTGPLYRRFADDMDLNDSIAARTGARAVLVFEDTVDLPANQEASR |
| A0A243SAI8 | 1-73 | None |
| A0A6B3DLY0 | 1-87 | None |
| V6U650 | 1-80 | None |
| V6JSH0 | 1-72 | None |
| A0A212SVQ3 | 1-88 | None |
| A0A6B2S7X9 | 1-72 | None |
| A0A2U9NYZ9 | 1-70 | None |
| A0A7Y0B6U0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.