DPCstruct | MC6665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J6XIQ4 | 110-285 | CTPSNDLQRRDSNGKPLYDAAGKPVLVPGKVDAYRFLTFYLGETSANFDDFYHKVVDPTWLSGSNAPDAAALRQTRQSSAKPPCWRV… |
| A0A7K2Q7Z7 | 3-173 | PSNDLQRRNSNGKPVFDPAGKPVLVPGKVDAYRFLTFYLGESSANFDDFYHKVIDPIWLQGSNAPDAAALRQTRQSSAKPPCWRVLH… |
| T0K920 | 719-892 | None |
| A0A562IJI0 | 780-954 | None |
| A0A291QN46 | 349-522 | None |
| A0A0U3I2P8 | 417-610 | None |
| A0A846DF83 | 208-364 | None |
| A0A0L0EQD6 | 285-456 | None |
| A0A090MCT5 | 47-228 | None |
| A0A428STM0 | 360-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.