DPCstruct | MC6663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10990 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5X8C8 | 5-125 | RGRLVAAALAVVALGLACRTPVAPRFAELYLGDVLWGALFFLLMAACGPNARRGMVGLAAAAATELIELSQLYRAPWAESLRQTRLG… |
| A0A3N6DY42 | 18-139 | RAAALAAALVTVAAGLGVRAAAGGDAAGGDVAKYAGDALYTVLIHTLVVLLAPRVRPLTAAGVALAFSWAVELAQLTGVPADLARHS… |
| A0A5C8WJH7 | 9-133 | None |
| A0A4R9BQR7 | 74-207 | None |
| A0A0Q5RA17 | 5-129 | None |
| A0A1H0RHQ6 | 2-116 | None |
| A0A087PQK4 | 35-169 | None |
| A0A549T3T4 | 1-116 | None |
| A0A2Z5G165 | 7-130 | None |
| A0A2W1NZG4 | 21-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.