DPCstruct | MC6662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255T714 | 5-99 | MMRQDTDLSTVPIIVCKDVEKDVIVSLLSQIGWRSHIQSVVSETDLVNWYEKALRGQYSELLADKLLYVLLKKLQKSSPPSITHQIL… |
| A0A7C3BVC5 | 2-85 | IVCKDSEREIINRVCQQLGQRIQGLIVQSQLVEWYNRALRGDFSKQLATDLLRSLRQEYRNEFPFRETLRDFYKERGYQRIYQP |
| A0A1Y3A1I9 | 7-119 | None |
| A0YZ87 | 590-682 | None |
| A0A7V5TNF7 | 66-189 | None |
| A0A661SL98 | 60-145 | None |
| A0A7V5S0H4 | 3-105 | None |
| A0A3D8HQ03 | 112-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.