DPCstruct | MC6660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A786PA96 | 1-73 | MKTELTLNVLQTMSAQEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTPAHERF |
| A0A377TDB4 | 1-56 | MSAVELEQFAERGQDYRHVLSCSVLNILKVPQGCVVEAEYGSEFGGLYPVTLRIAP |
| A0A402WM19 | 16-74 | None |
| A0A7H4M7J5 | 13-72 | None |
| A0A3G4RTU5 | 45-117 | None |
| A0A3S4MXH3 | 201-271 | None |
| A0A1X1EN27 | 24-100 | None |
| A0A6P1Q770 | 24-92 | None |
| A0A221ZN54 | 1-60 | None |
| A0A4P6WDQ2 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.