DPCstruct | MC666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423TV51 | 1-116 | MAEGLQAFIEAIVKETVSLVISRQLLSDVSTHLTSMADHVAKTVAHFTLDKVQPRVISFEEQVASIRQHLADIYERESSWRDAAAVL… |
| A0A453IR84 | 41-170 | DSALASAAAIADQRQKIEQYRHILASVISSSPPDIPQAKRFLNHMVSDEVPLVVSRQLLQTFAQELGKLEPDSQKEVAHYALTQIQP… |
| A0A1Y1WJV4 | 5-146 | None |
| A0A2H1CIU1 | 6-141 | None |
| A0A820X6A4 | 4-141 | None |
| A0A6A5AZ42 | 3-131 | None |
| I1CDC3 | 3-136 | None |
| A0A7J8NUV2 | 2-129 | None |
| A0A2S6C1A8 | 822-952 | None |
| A0A6A0H3S1 | 11-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.