DPCstruct | MC6658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 280 ± 39 aa |
| Standard deviation of domain lengths | 38.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109LIU4 | 246-548 | FNLLGSLQQTITLPLASVDEVRLLRPAVPEEVLLLINVGIDPLKHHRDLNILMTTERTDSLSYAGVRDNLVLTLDQVTLNSWNEVMV… |
| A0A377PDW7 | 6-279 | WRLSSTWKNDPTAAFRNQVVHFDFRKLDVFSFGQQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPESVE… |
| A0A4Q6E3W2 | 20-283 | None |
| A0A380QEA4 | 339-657 | None |
| A0A4Q6DUP4 | 3-224 | None |
| A0A6L2ZQ34 | 526-835 | None |
| A0A7V5HA50 | 123-416 | None |
| A0A378NAF1 | 6-290 | None |
| A0A377ZRS2 | 1-210 | None |
| A0A2A5CWB4 | 538-849 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.