DPCstruct | MC6657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 65.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9GR67 | 3-62 | NNSNNLLVPGIEQALDQIKYEIAQEFGVQLGAESTSRSNGSVGGEITKRLVQQAQSQLQG |
| A0A0Q9HPF1 | 17-65 | EVAIDQMKYEIASEFGVNLGADTTARANGSVGGEITKRLVQMAEQQLGG |
| C3BMT0 | 21-89 | None |
| A0A844LUX7 | 31-93 | None |
| A0A1Y4QCD6 | 8-66 | None |
| A0A151YYQ0 | 20-78 | None |
| A0A350X1L3 | 3-59 | None |
| A0A2C1A6F2 | 2-64 | None |
| A0A133KPL2 | 73-136 | None |
| A0A0M0H6D3 | 2-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.