DPCstruct | MC6656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8ZXS4 | 6-184 | KLTLFFSSFSPLFFIIFIQNINFEKVNKENFNIDILFQSKYIAIAMFILFVIPNLMLMLLFFRCKKRTPHNRIIDSISHKNNDVLNY… |
| A0A4U6QAP5 | 11-191 | QPALGVRGLMLVAAYAPLLVLIAVLDSFALGSSDAPWLRWLPALVAGTGVLVTVVFVAVAVRRRATEPEVVFEARPRDGEAIRFFAT… |
| A0A2S5AHG8 | 1-178 | None |
| A0A0E3NJZ5 | 3-224 | None |
| C5B644 | 187-385 | None |
| A0A2T3JVA0 | 7-179 | None |
| A0A4R5LW64 | 3-178 | None |
| A0A1N7A0P9 | 8-187 | None |
| I4A774 | 120-344 | None |
| A0A1M5RAP2 | 3-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.