DPCstruct | MC6655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0FG42 | 24-110 | AQEKKEKLKDQEVDASCGLCQFGTKDKDCILTIRYQNKVYTVVGSHIDDHGDAHASNGFCNTIRKAKVSGTLHQGKFLAKKFNLTQI |
| A0A848T0K1 | 1-77 | MLVQASCGKCKLGMEGKSCMLAVVIDEEKYYVEGAGDIHDHDAHGKHGMCSTVRKAYVTGEVKDGKYHATHFELVPV |
| A0A7Y2FH88 | 107-181 | None |
| A0A353DUF5 | 295-377 | None |
| A0A2A5G474 | 1-67 | None |
| A0A424SSC2 | 2-68 | None |
| A0A518GBU3 | 21-113 | None |
| A0A7Z9HUG8 | 84-166 | None |
| A0A2H0PIF7 | 10-96 | None |
| A0A7C1XHI2 | 36-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.