DPCstruct | MC6653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 115 ± 27 aa |
| Standard deviation of domain lengths | 26.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8U335 | 327-441 | SKDDFLARAKTICERSAKAQEELSFEALANELSPQDPERLMTVLADPDLRLNDGFVPDRRALGALIKFKGKTPTWSIEFNRDAITRG… |
| A0A838F9Z9 | 29-121 | EDISLSHISSMIDEDSPDAFQKFAASEKYAVSAYVKGHKQTLKSLKFYVYRSTKLTIEFDSSLINESIFYNANKNELRIKNVPDELR… |
| A0A125SGF2 | 160-316 | None |
| F3LHK7 | 9-98 | None |
| A0A160FN37 | 77-232 | None |
| A0A5D4L8U8 | 1-146 | None |
| A0A5E7Q7X7 | 8-100 | None |
| A0A7W1HH49 | 11-118 | None |
| A0A336N5B8 | 20-150 | None |
| A0A3M3FD26 | 317-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.