DPCstruct | MC6652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 184 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0198- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833E8D7 | 81-246 | DTQLVLGASGESDRDVIALVEYLAESGVGRVHFSPYTPVRGTPLASVRSRPTPLWRSRQLYEAEVLIRDYGFRAHDFEPILDDEGNI… |
| A0A838F7S6 | 22-207 | KKFAPAGQSTQLIIGATPETDKDILFTANHYYKTYQMKRVYYSGYVPISSDNRLPAIGTCVPMLRENRLYQADWLLRFYGFSVSELF… |
| A0A7C4HDQ0 | 364-552 | None |
| A0A7Y2JIM6 | 16-202 | None |
| A0A843GBX7 | 7-188 | None |
| A0A855HRJ6 | 3-162 | None |
| A0A349UMR0 | 286-472 | None |
| A0A2A2K6X9 | 376-581 | None |
| A0A3R6JTW5 | 322-507 | None |
| F3KE12 | 59-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.