DPCstruct | MC6650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 201 ± 37 aa |
| Standard deviation of domain lengths | 36.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF04479- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1LQX0 | 265-426 | SPTTEDSHPIARLINDANSKFDKKRTGQSKSLKEAVQEYRRRYGMPPPPHFDKWFQFAQERGVQLIDEYDTIYNSLLPFWAVPPKVI… |
| A0A0U1M494 | 171-360 | KKPETESRFKLSMKNWAFRLLLVFYAGSLILTVKTRNQSQTLPIDILIQNGREQHEMYLNQAKVSNNLKEAVLEYKRRYNQYPPPGF… |
| U7PQK5 | 12-227 | None |
| M5G0W8 | 4-244 | None |
| A0A1L7VSQ1 | 305-445 | None |
| A0A6A5ZK84 | 165-343 | None |
| A0A0D0TT73 | 125-326 | None |
| A0A836ARP6 | 6-230 | None |
| A0A146HSZ8 | 648-923 | None |
| C4JVV0 | 269-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.