DPCstruct | MC6649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 544 ± 48 aa |
| Standard deviation of domain lengths | 47.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1LYX9 | 2-523 | KRYEKPDRVYGLKQTDNFKLLLDSDDKRSATTTPSLSLRETIEVSPFKPEGQPLLYPFLIIEAKSSKGADRGEVNMQTAFVIRRLLN… |
| A0A6A6DQU6 | 2-525 | KPDRVIGLRAPSRIPQNASHFPVTGRRILLPFLVVEAKKEEDAPGFRAIQYQTAFPVRRLLKAQDDLRSREQSSEPCLVWFFAYQGE… |
| A0A366QK53 | 92-615 | None |
| A0A4S3J2T1 | 85-589 | None |
| A0A5M3ZBW3 | 323-959 | None |
| B8LUH5 | 119-646 | None |
| A0A1B8BWK6 | 175-671 | None |
| A0A0D2ES55 | 1-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.