DPCstruct | MC6648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7M2N3 | 231-375 | FLAYTTIYLDVGGVRGAGVGLLALLTWPLPLALLAYHIYLIWAGMTTNESGKWSDWSDDMAEGVVFLGHRQEDTMHSTVEPDEEEEP… |
| A0A0U1LP46 | 40-202 | AGLSWSTFINYWGYAITDDLQIGAIFLLAAMTAPLAFGFLVYHCYLIWAGMTTNETSKWDDWKEDIADGLVYRASKSEIYRAPKPRN… |
| A0A507EB46 | 23-214 | None |
| A0A218YUG1 | 2-115 | None |
| A0A507FLI9 | 370-545 | None |
| A0A4Q4S691 | 58-257 | None |
| A0A7S2XUR9 | 232-415 | None |
| A0A015JQV7 | 14-169 | None |
| A0A0S7DLX8 | 2-143 | None |
| F9FLA9 | 191-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.