DPCstruct | MC6646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 280 ± 47 aa |
| Standard deviation of domain lengths | 47.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150FUQ6 | 15-397 | RVVQQLLWDVISQHLYPAERDEIRRALGGSLLDENATLFAEAGALADILGDVQLDNAALLARQALCSNPQRSMVESEIRMLIDRLHC… |
| A0A674MJ87 | 9-243 | LCWPSQSLWSLIAEHVPGSELPKIRTALGNSLVDMYIDLYAEAEMWESLSAQRGPGRGGGAAPRPPQLADPPAIKELVRAEVKMLLQ… |
| A0A1I8I7B6 | 2-279 | None |
| A0A1Q9D734 | 198-514 | None |
| A0A7J6B6L4 | 1-293 | None |
| A0A7S2ENY6 | 6-296 | None |
| A0A813PIP7 | 9-327 | None |
| A0A6G0XJE0 | 1-270 | None |
| A0A819NS86 | 12-289 | None |
| A0A146P451 | 1-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.