DPCstruct | MC6642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 241 ± 32 aa |
| Standard deviation of domain lengths | 32.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8K9P0 | 9-270 | RRLAFRLLFLFSAVVLLYALLYGLLTKFAPGNGVEFKDQIPHWTDFIYFSIVTVSTLGYGDLAPVGWSRALAASEALFGLLFVGYSI… |
| A0A174KWN0 | 46-314 | IKKIRKGREWYMKIFLQKTKLLTAICIISIFVSISKVVTAELPEWFNGAEEWFQFIDNLSMAYIASYLFYIVQVYIPEKKKEDSLIP… |
| A0A7J0BLZ4 | 19-281 | None |
| A0A849TEH3 | 3-237 | None |
| A0A2N7MSD1 | 18-244 | None |
| M5E1C8 | 3-215 | None |
| A0A3D0DTB0 | 58-323 | None |
| A0A7C3VUU1 | 5-250 | None |
| A0A2T1C0Y4 | 13-256 | None |
| A0A1H9YF94 | 12-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.