DPCstruct | MC664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 66.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453IGW6 | 15-106 | EGDTGQKMEGVASIALLPSGAISGHFIRLPDSACYGLQGTPIPCERECSRGDDYRLIKLSIINFKRKTEKVVVVECRGHDAARLQNI… |
| A0A1Y1HNS4 | 7-95 | IEGVASLALLPDGCISGHLIDAVTKMSYGIFGKEIKCERECSRGEDYKLVDLTILEFKSQKECTLVVEQRGADAARIRTAEDAHGWE… |
| A9SJJ3 | 5-83 | None |
| A0A1U7ZWN2 | 3-97 | None |
| A0A4Y7JK66 | 6-93 | None |
| A0A3Q7FE51 | 1-105 | None |
| W9R4M2 | 1-102 | None |
| A0A0K9P7R2 | 301-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.