DPCstruct | MC6639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374NYC2 | 3-145 | IAKMSMIHNSYRYFTISVDKYEDRCMKGVIYHAGKTPGIRYDNFLEMIIQMNRIFDSMSCPKQAMELRRFTGIEYPEPVIRECNRYQ… |
| A0A173WIR6 | 4-138 | VLIIVIENCRNQTINGYLQSLYQEKSFCFHGLDHMLLLMEYILDREGMPVDSGDRRHLVKMDLVKKRTKIISDAETVPRTVKFCPIR… |
| J1H9P8 | 33-187 | None |
| A0A498CYR8 | 11-160 | None |
| A0A7G9B1X1 | 7-144 | None |
| A0A4R1QEJ3 | 3-145 | None |
| A0A316MFM5 | 2-107 | None |
| A0A2V3XT66 | 26-194 | None |
| A0A1C6FYT2 | 60-212 | None |
| A0A3A8U916 | 4-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.