DPCstruct | MC6638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BPB5 | 86-157 | FAPDVPQMHVIDHTKGQPSESESRNVLTESARIARGKITDLAQLSAANHDAAIFPGGFGAAKNLSTFAVDGK |
| A0A3Q7P9P3 | 9-68 | VKLFAPNAEQMYIVNHLKESPAEEKRNVLEESARRAHEDIEDLADLNPSKLEAVIMPPAG |
| A0A212C4B3 | 24-75 | None |
| A0A4W5L3F0 | 73-132 | None |
| E9I992 | 33-94 | None |
| A0A340Y296 | 40-95 | None |
| A0A7R9DJG3 | 215-271 | None |
| A0A1I8G132 | 79-145 | None |
| I7LTA1 | 82-150 | None |
| A0A818JS60 | 52-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.