DPCstruct | MC6631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840CE51 | 19-190 | NRNTKTPNYWNTRQNELQIDIQKPGKGYKHFLKKRDIKQFWELLPDKDKIEIELDAIVLAEGNTICDGWYQNGVICICAWEKEMTRE… |
| A0A2G6UH72 | 2-146 | KLKKLPNDHVKYLTHIWLDKVKKSDYLKGETSQGEFIFGSKVYLIKLYAVPKDNRMIFGSIKPTAKQLSFYKQYCKDLQHDKNGWYL… |
| A0A7W0Q574 | 136-285 | None |
| A0A3A4NM54 | 12-174 | None |
| A0A259TUL1 | 5-134 | None |
| A0A5B9VTL7 | 1-155 | None |
| A0A1V5LQD9 | 21-190 | None |
| A0A2V2RXB4 | 413-578 | None |
| A0A535KN16 | 55-223 | None |
| A0A1W9J959 | 32-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.