DPCstruct | MC663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 13.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9TXW4 | 12-101 | ALLTACAKKGTYPSQLMWDDTIYGVSTEIVESKDIGDEIGEIRKKVSPMPQKNGEANDTEVGSKLYKIWGVDQKNSVAIKKNDTYVK… |
| A0A7C6LQV0 | 1-75 | PTIMVGDRLYFSQGVDVNVDIDKSEYLGTITSAIDDTKMPIENGQANFEGKGAPYAVYKNGVILMLEGKWFFFEI |
| A0A2R5ENG4 | 23-149 | None |
| A0A1R1DDE2 | 3-94 | None |
| A0A378ZNZ2 | 9-125 | None |
| A0A3G1KRT5 | 30-136 | None |
| A0A7X7IH42 | 3-91 | None |
| D9SMM1 | 17-108 | None |
| R5LLB1 | 89-168 | None |
| A0A1I5YY96 | 19-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.