DPCstruct | MC6629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8X9G0 | 101-188 | RVAALRAANPNASTSVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDKL |
| A0A539DZL4 | 202-293 | IRERVERLRRSNPAQSAPIPIDLVTASGSGLDPHISPAAAYWQTPRVAAERGISIEVVRNLVGARIEAPTFGVLGASRVNVRLLNQD… |
| A0A842HB19 | 15-99 | None |
| A0A0P9ZDE2 | 3-69 | None |
| A0A484VRV7 | 99-194 | None |
| A0A7R7UX60 | 76-175 | None |
| F4KRA8 | 103-188 | None |
| A0A258TWW0 | 84-167 | None |
| A0A1G4UPH1 | 33-117 | None |
| A0A855A9E1 | 61-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.