DPCstruct | MC6628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 252 ± 25 aa |
| Standard deviation of domain lengths | 25.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E8G0 | 1-228 | MEAKNETFAPQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSRDYNKPRGHAFAVTDVRETLRTGAPKNAEDGPLPMACWS… |
| A0A539DU92 | 35-290 | IETRKHEARTTHVRLVEVGEDDTDPAKWGVNWPKEYDSYQRTALTTRTRFGGHGGSEALPAEKIERDPWLKRMFLGYAFSIDYRDRR… |
| A0A1W2B5E3 | 536-767 | None |
| A0A7C1H7T3 | 24-291 | None |
| A0A6M8J515 | 12-262 | None |
| W8KQB3 | 16-252 | None |
| A0A378MW62 | 3-272 | None |
| K6VDF3 | 2-244 | None |
| A0A376NYE6 | 26-265 | None |
| A0A0E2M4S6 | 14-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.