DPCstruct | MC6625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2LYK9 | 105-190 | KPREIILSGRYSRNPRFRMLVQKRLRDIAPVRIIGMLSGARFSKEAAQGYGIVAGGIAGGEFKDLIRHMQLMDARGTVLSWVFHPR |
| A0A2H5V6N1 | 1-108 | MLAAVMDKRPREVILTGRLSRVESIREAVASWLQRKLGFKARRPLNVFAKRAKDVAMGAALIANGLGGGKYSELVENLEIRRARGSV… |
| A0A7J3XF89 | 2-90 | None |
| X1JXN9 | 1-94 | None |
| X1J7V8 | 65-153 | None |
| A0A522V8I5 | 22-117 | None |
| A0A1D2RD12 | 1-79 | None |
| A0A2V8DLC8 | 164-248 | None |
| A0A832ZNU8 | 22-127 | None |
| A0A7C1LY95 | 165-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.