DPCstruct | MC6622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 268 ± 47 aa |
| Standard deviation of domain lengths | 47.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1D7L8 | 33-302 | TERLQTARKNIIKNGYIAKYDDAELLDLVKSGELANERFHVRIVQQSADKVLESSLGFPRPGTKRAPYWTTTFEQMEAADTDPYLIG… |
| A0A814LWG9 | 140-376 | KRFVIRDKMNDYIQAFNNGLNYLPDNCDLTGLYCRLTKGITDDDFFRLSQDPTKRLTWVYDHETLRSLLGMSHLEMLIHSGHTIEWI… |
| A0A812PV84 | 18-243 | None |
| A0A2M9K4B7 | 7-309 | None |
| A0A259MFQ2 | 31-281 | None |
| A0A812MJ85 | 6-269 | None |
| A0A7S2UYZ7 | 8-266 | None |
| R1BSY4 | 176-427 | None |
| I3CL72 | 28-301 | None |
| A0A3N2DK55 | 340-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.