DPCstruct | MC6621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.66 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0020- CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W4ZNT1 | 17-141 | PQIDKTPLPEGIPAVDEVGATSAPLKAASYFIGARCKPFNEDYMLCKAENKGKGEEPCLKEGRRVTRCSISVLEDLHTYCASSFKKY… |
| A0A507DTD6 | 243-372 | GIFVEGLWTEPTASLPAPLDVSSEVGATSAPLESMAFFFGSFCAKYTADYVLCKNESTDPAHCLLEGRRVTRCAQDLIRKMKDSCDA… |
| A0A834TTA9 | 187-292 | None |
| A0A7M7GGU2 | 7-137 | None |
| A0A421JK82 | 112-246 | None |
| J4U905 | 166-289 | None |
| A0A3P7DDV9 | 8-168 | None |
| A0A4C1ZTE7 | 3-139 | None |
| A0A7S0TKP6 | 13-124 | None |
| A0A218X0U4 | 19-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.