DPCstruct | MC6620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 176 ± 17 aa |
| Standard deviation of domain lengths | 17.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A197K981 | 1-147 | MDWNSYFALRGTRRLYERVFMVPSTLLGLLGGGYYFAHQDFDPTISIFGMDQVLLYGLGTVGVGLVGLAVGPVVGNVIFRAVHANAR… |
| A0A507DT51 | 1-178 | MRPSLHRHPTIHPRAASTSTPTQPPHVSRGGIPWSQYFALRHQRTTFERSGAILGGIFGLCGGSYYFGAVADFDPTTPIFGIDPAIA… |
| A0A1R1XAZ5 | 34-185 | None |
| A0A168AX77 | 227-399 | None |
| A0A0E9NAY1 | 19-195 | None |
| A0A1Y2G657 | 96-295 | None |
| A0A0J0XCK7 | 1-152 | None |
| A0A225B161 | 223-414 | None |
| A0A0F7SU31 | 39-234 | None |
| A0A0F4YST7 | 405-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.