DPCstruct | MC662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9HM21 | 10-107 | EGLIDVLLDQSAEVGDRDDAAMDLGAYDGEDVEAALAQVACDPATDEMIADSCGQSLAELWCRKGRVNDAILVRLTPASLRISLALL… |
| A0A0Q9T4V1 | 1-87 | MAREDERDDAAINLGNFEGDEVIQALFTIAMDELFRSEMTKGSCGESLASIWIRTGKIDFELLSQLEGTALNEAIGLIKESRMDWYL |
| A0A2M7L4I9 | 8-101 | None |
| A0A286PGX5 | 25-128 | None |
| A0A535QLQ9 | 2-89 | None |
| A0A4U0RB50 | 72-178 | None |
| A0A4R3B4Y7 | 134-230 | None |
| A0A0F2TMH0 | 12-111 | None |
| A0A2A4TYM5 | 131-221 | None |
| A0A4R1Y546 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.