DPCstruct | MC6618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 308 ± 73 aa |
| Standard deviation of domain lengths | 73.37 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0272- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9XPC5 | 51-260 | DVRLEDVLDRKHLPPLGLKDFEEWLLFVEMSPENLYFTLWLREYKQRYNQWAAQTRFQRESSSEFRTNWSSHNSPQLAMFYARAKQT… |
| A0A507DKQ0 | 15-300 | LESILAGETCPPLSLRDFAVYTRDSEHSEENVLFHLAIARYTEGYTRVIARDSRVSVVKTLKHSLSSPNKAAAPFANNVAPNASNNP… |
| G8BAH5 | 315-588 | None |
| A0A0G4MYP8 | 4-260 | None |
| A0A4Y7Q470 | 54-266 | None |
| A0A4R8THQ3 | 62-349 | None |
| A0A0K6FP89 | 495-724 | None |
| A0A2N1JCL2 | 5-262 | None |
| A0A139AVL0 | 284-549 | None |
| A0A060SB59 | 56-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.