DPCstruct | MC6617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 52 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4TW76 | 25-66 | PQAGDYWSGCNAARAAGTAPIYIGEPGYQENMDGDGDGIACE |
| A0A844QA49 | 211-270 | TSSSGGSSGSTNTPVPPQQQDNVYYKNCSEVRAAGKAPIYRGQPGYASHLDRDGDGIACE |
| A0A2T8HP76 | 53-102 | None |
| A0A5N0VKL4 | 205-264 | None |
| A0A559KAH9 | 117-172 | None |
| A0A1R1GQE7 | 144-194 | None |
| A0A4Y8X2I3 | 403-453 | None |
| A0A1S1RGJ3 | 134-192 | None |
| A0A4Y9LNE6 | 194-250 | None |
| A0A087BZI7 | 258-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.