DPCstruct | MC6614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 209 ± 19 aa |
| Standard deviation of domain lengths | 19.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7U9D2 | 1-166 | MAAVPAAQAQGSLFTAVPVDTSKFILVSAPIGNGERSQLNIYEQRSEKRPCFAVSGSSPATVDPLLSTFDFTGICNRYIDGNGYSLR… |
| A0A2G4HQ81 | 1-227 | MTRLVRPLAVLLSLVGLTAASWAPAPPARAQASMFSTQEVDQGKFIIVAAPIGDGSRGQLNIYEQRSAQRPCYAVSGSRPALVDPLL… |
| A0A0M1JTD5 | 1-172 | None |
| A0A358C0X7 | 21-223 | None |
| A0A2K3BIV3 | 3-212 | None |
| A0YZH2 | 1-207 | None |
| A0A7T1MC03 | 63-262 | None |
| A0A2W7BBJ1 | 1-225 | None |
| A0A7Y0ITG1 | 1-224 | None |
| A0A522XG16 | 14-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.