DPCstruct | MC6611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 575 |
|---|---|
| Mean domain length (aa) | 361 ± 61 aa |
| Standard deviation of domain lengths | 60.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.57 |
| Pfam Score | 89.82 |
| Assigned Pfam label(s) | CL0264- PF20146- CL0316- PF05739- PF06423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6W0V9 | 17-425 | LQRRLSGGVYRPEVDGLRFLAIAIVVVGHFVERALRFFPAAAEQRDSLVVEWIGRPGLGVQLFFCVSGFILAGQAMRSRHGPLTGAF… |
| A0A4Y8NJ63 | 2-260 | DYGRLVAAMGIVWFHSQAPGARLAYAALPFFLVLLATPSRAGLRVRAQRLLLPFLRWSAIYAALGTALSLRHHQPPLGWWDWPMLLT… |
| A0A3L7W421 | 294-680 | None |
| A0A3L7WSB9 | 64-450 | None |
| A0A3Q0J1K0 | 16-349 | None |
| A0A7M5WRE0 | 644-1085 | None |
| A0A7M5XCZ5 | 352-806 | None |
| G3JIM6 | 262-683 | None |
| A0A1V5V5P5 | 398-722 | None |
| A0A850F4I8 | 16-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.