DPCstruct | MC661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3LJX3 | 1-149 | MNHADLPEDYLAFINSGSQLEYDPDECEVGRVILFASDKLTPSVAFVDSYDTPYATSDPHAEEDGYYVVPIVNLIAECEGYDADGIL… |
| A0A0Q9S6F0 | 3-109 | SLLPKQLKEFIKEENQKVYFQDSCTDFVEFYKLSEIKKFEWNGIEVYDLLKEVENYESIGFLVWIPKFKSLGSIDIEHDNLSLFQGI… |
| A0A0E2BEB5 | 13-161 | None |
| N1UBY6 | 5-148 | None |
| A0A1M5VTK2 | 19-156 | None |
| A0A518HRL0 | 2-143 | None |
| A0A559J043 | 219-336 | None |
| A0A496M4Z7 | 91-197 | None |
| T0GTL2 | 26-163 | None |
| A0A401UKI4 | 255-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.