DPCstruct | MC6607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 155 ± 23 aa |
| Standard deviation of domain lengths | 22.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9AGU5 | 2-129 | LAGALGGIAGGLVFGAMMATMGMLPMLAGMVGSTSPWVGFGIHMMISVFFGVVFTAVASRWLRTWGTGLLVSMLYGIVLWVVGPLVV… |
| A0A1H8WSH2 | 65-209 | TGVEGRAWQAGVVGGLFGGALMGVLLSVLMTPVIQSAIPALWGLSGGVAGWVIHMSNSAVLGVAFAALAKALPQYSSSIGRSTALGA… |
| A0A2R6BLJ2 | 30-234 | None |
| A0A2R6IFC8 | 29-141 | None |
| A0A150TEN6 | 12-179 | None |
| U1P6Q3 | 131-266 | None |
| A0A7X5VM29 | 24-201 | None |
| V4ZQK8 | 124-257 | None |
| A0A2R6HF63 | 5-151 | None |
| A0A150QMQ3 | 83-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.