DPCstruct | MC6605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0FDY2 | 24-107 | TDAERIDYRIEPQAEGCETADADRVSEFDELSPDAQEVFLSTLRSDGEYTTTESPDQFRISSDNDVENYVVYESDCYSLVGYGA |
| A0A2R6DZG3 | 6-77 | GSVLVAESVDEADANEAENRVAFSDLTATRQDLAERAIDGERPAVDAETWPWFESTVVVEHRGEYYQFYTVT |
| A0A2R6MDM6 | 104-181 | None |
| A0A1I5WJ76 | 6-92 | None |
| A0A343TMH2 | 16-100 | None |
| A0A3R7IVU7 | 34-115 | None |
| A0A2R6HKE1 | 37-124 | None |
| M0D3C3 | 1-94 | None |
| A0A2R6HXD5 | 33-98 | None |
| A0A830EX49 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.