DPCstruct | MC6604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 345 ± 43 aa |
| Standard deviation of domain lengths | 43.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843HE03 | 3-389 | NNLTLKAGTYTLSVKGKHVGAILYFRNEDVSPAVYYFIGSSNDDDSVTFTLDNDVVNSRIYFNAGNADINVDIDCTIQLEEGTTATS… |
| R5GWS7 | 305-595 | GKNLIPFPYPELGGAGVQTEKEGVKYTVQGDGGIRCTGTPSSQFGVIIARIAYSATALSISNPSNGKIVLSGGELYFDPKNNALFIY… |
| A0A415JI97 | 82-409 | None |
| A0A316MA14 | 342-694 | None |
| A0A316LNK8 | 327-614 | None |
| A0A316LFW6 | 505-808 | None |
| A0A2N2BYR6 | 3-333 | None |
| A0A401HW24 | 379-788 | None |
| R7IUB1 | 451-832 | None |
| R6HFB0 | 362-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.