DPCstruct | MC6603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832UGC3 | 5-167 | IFTLLDTTETFDYADYVDFCEANEITPEPENSDDYWNWVSEERQRIVEDFLINLQYAKINDEPVMITGSLGLWNGRKEIYPMVVEGS… |
| A0A3D4MV10 | 7-170 | IIWSNDIDYDDWREDLEEQYPDLTEAERMELMYELNGDYLDDERSNLDIQLSRPILVVSDLGLWHGRRMGYKEIPSGNIRDCLYSER… |
| D6DD36 | 17-181 | None |
| R7ERY0 | 94-256 | None |
| A0A517D8P9 | 4-139 | None |
| A0A2K9BEL8 | 12-111 | None |
| A0A0H2PLD4 | 226-375 | None |
| A0A0C2UGV7 | 11-163 | None |
| R6U642 | 6-169 | None |
| A0A2T3GC59 | 82-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.