DPCstruct | MC6601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9BIN1 | 71-203 | QQWVYASLKGCRFKGSLSGCDFGHWPDYSTGAENGAIEDCDFSEARLDGCRFMGCDPRTLRFPKWPCFTILNPIRNASELRRATWPG… |
| A0A832SXP1 | 32-168 | RFERCDFNGIVDSAWFRGGFPSKEDVKEFGKAQQNKMKEVSFANTELHHVHFSDNCDLSTIILPKRGHYLFFDDWDRQLNAINKCTV… |
| A0A839QX41 | 1-146 | None |
| A0A4R4WI29 | 16-156 | None |
| A0A268SNN9 | 121-249 | None |
| A0A7W0CL04 | 2-117 | None |
| W8PKV0 | 5-137 | None |
| A0A7Z0IP81 | 141-278 | None |
| U2RLF7 | 110-252 | None |
| A0A428W5T2 | 86-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.