DPCstruct | MC6600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6FK41 | 1-67 | MISHVTALNIKTVIESFSGEEVFGRKEIKERLGYKDSKAGFLIEKIQEFELIKAVRGQGKGKYCFDI |
| A0A832RJ47 | 75-139 | FSTKTEMYVRRLFDQFCFDQVFGRSAVMEVLDIKTSAASNLISKLYGADIIERVSGHGKGKYKFK |
| A0A3A6JHC9 | 89-159 | None |
| G1WSA3 | 271-353 | None |
| G9WNG3 | 414-487 | None |
| A0A415L383 | 22-84 | None |
| A0A1H2X7I4 | 77-142 | None |
| A0A417T3U9 | 111-188 | None |
| A0A7X8AR63 | 19-88 | None |
| A0A1Q6NF53 | 85-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.