DPCstruct | MC660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496P059 | 4-111 | VQKVVDSECMRYMEPYIPKRTGVLINSMLLSTVIGSGEINIKTKYAHYMHEGIVYVSPTTGSPFAKRNEVKVPTTRKLTYIGAPMRG… |
| A0A3E2XCL9 | 15-130 | KLGQKGSLNLGICWKADLAGRYTEAFERLQKEADGEFVRLVKPYIPLRTGALAGSTNDHTVLGSGQIVQATPYAAAQYYRLPCGRGV… |
| A0A355V0F3 | 1-110 | None |
| A0A6L5YLT4 | 6-113 | None |
| A0A355JEL5 | 9-119 | None |
| A0A3A6E9X1 | 36-154 | None |
| A0A369MQW9 | 3-89 | None |
| A0A352TI11 | 1-97 | None |
| D4J8N3 | 77-190 | None |
| A0A3B9CD13 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.