DPCstruct | MC6599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 13.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2BHF7 | 8-166 | TDWLDVLYNSVRRTQGSVNDAARFLTERRGKSIHPESLRAKLRSHDDSISVEMALMLTEWMDEKAGGSEYSRDWMQTMAVEQGLAVD… |
| A0A7S6MGW0 | 26-196 | LNKHDALYIAARSYPGGVEALAARMGISPNVLYKKLRRAVDSHHLNYEEASQIIELLSDSGRDQMVDLAIRSFMWRHGYVAYRIPGD… |
| A0A327KII7 | 9-169 | None |
| A0A2G2LBK9 | 23-165 | None |
| A0A4C5WR87 | 41-183 | None |
| A0A2D6W7H2 | 3-147 | None |
| A0A3B0YW08 | 157-309 | None |
| E1JQY5 | 9-149 | None |
| A0A3B9NVG2 | 2-140 | None |
| A0A1M3HI75 | 15-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.