DPCstruct | MC6591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 121 ± 31 aa |
| Standard deviation of domain lengths | 30.87 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9YQX7 | 118-222 | WSWLRWPAFGFAAIAMAILLVYDHRPSAVSHSTFIGQADFGAYCQAQSYTTASLTGHTAYDWKCTGPQERSEPISAVRACRWQYHSA… |
| A0A2W2HBK9 | 204-267 | RLGPLDFTRYCAARGATARLEGDDAYGWRCDGALVDSQAACAALYPGGAVSRFQNFNDPRSWEC |
| A0A1R0KKE2 | 54-145 | None |
| A0A259XY29 | 4-102 | None |
| A0A6I4PYX3 | 51-195 | None |
| T0KD75 | 171-286 | None |
| A0A5M3W4G6 | 474-565 | None |
| A0A2V7QXY2 | 1-143 | None |
| A0A534WVJ5 | 1-95 | None |
| A0A1G7WF28 | 4-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.