DPCstruct | MC659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812W528 | 407-479 | QWANVGLACSGCRGRVQADWYGGHGCQYCARIGHRCTAAAAVGSTGTCEVSSDKRCDEDITTSHMLCTCEARD |
| A0A813KMA7 | 812-899 | SMQVTCGSYTPIWSRVSCSCGNCKVVVPKIQDTFKTCADYCKDQVGNPMCISSAKVHRNSCDKAADVTCDYAFAKDEDALCKCTALPK |
| A0A812NPP8 | 708-796 | None |
| A0A812KA87 | 315-403 | None |
| A0A812LH85 | 369-470 | None |
| A0A812J3I5 | 45-141 | None |
| A0A812VAM9 | 803-895 | None |
| A0A813K3M9 | 459-537 | None |
| R1E7R5 | 6-110 | None |
| A0A812VYK0 | 73-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.