DPCstruct | MC6587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 328 ± 37 aa |
| Standard deviation of domain lengths | 36.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3C5E7 | 1-303 | MSTKSIFFVCAFSLFGVVEQALGRPIFLANVNRAASSSNSTIGDFGSCTVPQIQFGTGFDNRKETSFEPVDQKSYNHGSAQNIDIIT… |
| W4K574 | 1-305 | MQNKSFIVLAAITALFFTESVVARPMWIMSRGRLVSVRRQSSNIGDFGSCSVPQIEFGVGFDNRKETSFEPVDETSFAHTSAQNIDI… |
| B0DAL7 | 306-551 | None |
| A0A166BNU8 | 235-584 | None |
| A0A5C2TER6 | 195-511 | None |
| A0A2R6NRT9 | 188-556 | None |
| A0A2H3JN38 | 210-587 | None |
| A0A1Y2BC77 | 233-553 | None |
| A0A165N9H9 | 230-572 | None |
| A0A165CPQ7 | 1-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.